SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|162450821|ref|YP_001613188.1| from Sorangium cellulosum 'So ce 56'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|162450821|ref|YP_001613188.1|
Domain Number 1 Region: 5-107
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 6.98e-24
Family Frataxin-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|162450821|ref|YP_001613188.1|
Sequence length 112
Comment hypothetical protein sce2549 [Sorangium cellulosum So ce56]
Sequence
MSGEPLSEREFDDVADRSLRALDRAINEIPDGVEADLQSGILTLEFEDGIKYVVNSHRAA
RQIWMAAERAAWHFDYRPSEDRWVAQKSGEELWSTLEAVLSRKLGRAVKLAR
Download sequence
Identical sequences A9G6L2
gi|162450821|ref|YP_001613188.1| WP_012235181.1.90317 448385.sce2549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]