SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159036858|ref|YP_001536111.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159036858|ref|YP_001536111.1|
Domain Number 1 Region: 3-172
Classification Level Classification E-value
Superfamily Prim-pol domain 3.33e-22
Family Bifunctional DNA primase/polymerase N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159036858|ref|YP_001536111.1|
Sequence length 290
Comment bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
Sequence
MLLHAAMEYAERGWPVFMLARSKRPLAGCERCDDKRGYDGHDRDICPCLTCHGFYAATTD
PDRITAMIDTAPRGQLALRTGRASDVVVLDVDPRNGGHRGLATLVADGLAPRTAYVITGS
DGLHLFYRHPGTPLAAKVPGVPGVDIKTDGGYVVLPPSIHQRTGRPYRWADRGPVQEMPP
ALATVCQPAPPPTIPTTPTPPVSTRSAGGISHPDLLLASHLDAVARAPEGHRRTTLYGAS
RGVARMILAHAITKDAGIGALTTAGRKAKQSERDISAAIRGGFRDEGLAA
Download sequence
Identical sequences A8M695
WP_012181428.1.69805 391037.Sare_1213 gi|159036858|ref|YP_001536111.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]