SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159037122|ref|YP_001536375.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|159037122|ref|YP_001536375.1|
Domain Number - Region: 135-188
Classification Level Classification E-value
Superfamily Prim-pol domain 0.018
Family PriA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|159037122|ref|YP_001536375.1|
Sequence length 341
Comment DNA polymerase LigD polymerase subunit [Salinispora arenicola CNS-205]
Sequence
MGGAKAVAEEIEVAGRHVRLSSPDRVMFPQRGFTKADVFHYYLAVGPGIMRALGQRPTTL
QRFPEGIEGEAFFQKRVPARGMPSWVHTAKISFPSGRTAAELCPADLAHVAWAAQMGTVV
FHPWPVRAADPDRPDELRIDLDPQPGTDFADAARAASELHGILTELGAPGWPKTSGGRGV
HVYLRIRPHWTFVEVRRATIALARELERRRPELVTTAWWKEERGARVFVDYNQMARDRTI
ACAYSLRANARATVSTPLAWDELADVDPDDFDLRSVPARLAERGDPHADIDDAAWDITPL
LEWAERDAANGQGDLPYPPEHPKMPGEPKRVQPSKDRDRPR
Download sequence
Identical sequences A8LUN1
391037.Sare_1486 WP_012181692.1.102098 WP_012181692.1.10772 WP_012181692.1.14007 WP_012181692.1.18430 WP_012181692.1.23841 WP_012181692.1.2519 WP_012181692.1.25902 WP_012181692.1.28651 WP_012181692.1.29185 WP_012181692.1.29984 WP_012181692.1.30836 WP_012181692.1.32557 WP_012181692.1.33355 WP_012181692.1.37892 WP_012181692.1.45982 WP_012181692.1.58464 WP_012181692.1.68706 WP_012181692.1.69805 WP_012181692.1.76231 WP_012181692.1.76773 WP_012181692.1.77205 WP_012181692.1.79888 WP_012181692.1.8104 WP_012181692.1.81166 WP_012181692.1.83049 WP_012181692.1.86246 WP_012181692.1.88482 WP_012181692.1.89801 WP_012181692.1.91622 WP_012181692.1.98430 WP_012181692.1.98445 WP_012181692.1.99814 gi|159037122|ref|YP_001536375.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]