SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159037549|ref|YP_001536802.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159037549|ref|YP_001536802.1|
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily Prim-pol domain 3.14e-29
Family Bifunctional DNA primase/polymerase N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159037549|ref|YP_001536802.1|
Sequence length 377
Comment bifunctional DNA primase/polymerase [Salinispora arenicola CNS-205]
Sequence
MAARWLGASKILGRPVASNDPYPHICGRLLPAERAHSHRPVLLQRRDCAACAHGRHQRRR
ATPDIPPAVMERTRTMSDNPLLNAALGHAARGWRVFPLRPDDKRPAFPDHPADDCTGRDP
RCRNAGCHLGWEPRATTDPDRIRRAWTARPYGIGLACGPSHLVVVDLDVPKDDSGGGPSG
TDTLAALASQHGASIDATYTVTTGRGGTHLYYRHPDGGPDLRNTAGTLGPMVDTRAHGGY
VVAAGSTAAGRPYTVSLDTDPAPLPAWLAGLLAPAPLPPQRPVVVELPGGRERSYVRAAV
ERECASVTGAPDHHNDALYFASIALGQLVAGGSLSADEASTALEHAGLSVGLRHRAVLAT
IASGFRAGTRRPRTVAA
Download sequence
Identical sequences A8LYU8
WP_012182115.1.69805 391037.Sare_1926 gi|159037549|ref|YP_001536802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]