SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159040298|ref|YP_001539551.1| from Salinispora arenicola CNS-205

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159040298|ref|YP_001539551.1|
Domain Number 1 Region: 5-110
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.21e-23
Family DNA-binding N-terminal domain of transcription activators 0.0023
Further Details:      
 
Domain Number 2 Region: 122-269
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.96e-21
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159040298|ref|YP_001539551.1|
Sequence length 274
Comment transcription activator effector binding [Salinispora arenicola CNS-205]
Sequence
MDDLIPIGRFSRMSRLSVKALRFYNEQGLLAPAWVDPSSGYRYYRRAQAERAEAIRVLRA
IDMPIADIRDLLADDDPELTGKRLVAHRERLRARLAEQERMLRFLEVLIDRGGRVMPYDV
IVKEAATIPVASLTLHTSLDAIGADMGRGFGTVVDAIGNAGAESNGKPFVIYHDVIDEQN
NGDIEICIPVPAGTVLPGDPVRYRELPGGRVATTVHRGPYQEISPAYHVVTGWIEQEGMH
PAGPPREVYLNDPQTVSPAELLTEVQFPIDRAPR
Download sequence
Identical sequences A8LV72
391037.Sare_4810 gi|159040298|ref|YP_001539551.1| WP_012184784.1.23841 WP_012184784.1.69805 WP_012184784.1.75797 WP_012184784.1.98445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]