SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163937879|ref|YP_001642765.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163937879|ref|YP_001642765.1|
Domain Number 1 Region: 34-103
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000104
Family NE1354 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163937879|ref|YP_001642765.1|
Sequence length 128
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MNNKDYVNFDRVTQESDVWQKRKYKGYAPLHRTKTPTGIRIVLGDYLKKIDMSQRSLAEL
CGLTQPMVNDMCENRTTFLNISHLVRITSVLGITVDDIIQITPIQETAYTESDSIHSVIN
GKRSGATR
Download sequence
Identical sequences A9VVH5
gi|163937879|ref|YP_001642765.1| gi|163937879|ref|YP_001642765.1|NC_010182 WP_012260027.1.99908 315730.BcerKBAB4_5295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]