SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163937952|ref|YP_001642837.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163937952|ref|YP_001642837.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000338
Family SinR domain-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163937952|ref|YP_001642837.1|
Sequence length 141
Comment helix-turn-helix domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MTLFDRVKELADGRGISIAELERNLGLSTNALYKLKKQKPSIDRVEVLAQYFDVSTDYLL
GRTEKKYWELNEKDEKDIQKKLEEIIEDMSNSDALAFSKGSEPMSEETRKLLIISLENSL
RLGKEMAKKKFTPKKYRNEVE
Download sequence
Identical sequences A0A2A7YLF5 A9VVP7
gi|163937952|ref|YP_001642837.1| gi|163937952|ref|YP_001642837.1|NC_010183 315730.BcerKBAB4_5811 WP_012260098.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]