SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163937953|ref|YP_001642838.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163937953|ref|YP_001642838.1|
Domain Number 1 Region: 4-53
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000248
Family SinR domain-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163937953|ref|YP_001642838.1|
Sequence length 61
Comment hypothetical protein BcerKBAB4_5812 [Bacillus weihenstephanensis KBAB4]
Sequence
MANEFGMKVRAKLFANNMQQKELANLLGISGPYLSDILRDKRNGKKIRENIIKILDMKEV
S
Download sequence
Identical sequences A0A1C3T0J0 A9VVP8 W4EZB4
gi|163937953|ref|YP_001642838.1|NC_010183 315730.BcerKBAB4_5812 WP_012260099.1.36226 WP_012260099.1.47957 WP_012260099.1.99908 gi|163937953|ref|YP_001642838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]