SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938059|ref|YP_001642943.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938059|ref|YP_001642943.1|
Domain Number 1 Region: 21-206
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.1e-72
Family Peptidyl-tRNA hydrolase-like 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163938059|ref|YP_001642943.1|
Sequence length 207
Comment peptidyl-tRNA hydrolase [Bacillus weihenstephanensis KBAB4]
Sequence
MRRNQAWLRLFVSKKESSGTRMKLIVGLGNPGREYELTRHNIGFMAIDELAKRWSISLNE
QKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDVEDFIVMYDDLDIPVGK
LRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKVVDYVLGRFTSEEISGVN
QSIENAADACEEWLNKPFLQIMNTFNS
Download sequence
Identical sequences A0A0A0WWF1 A0A150C166 A9VN64 C2SDZ0 J8A4H1 J8ABY3 J8BQE0 J8FC06 J9A7N9 R8HGP3 R8KRY4 R8PVK4
315730.BcerKBAB4_0046 WP_002029319.1.100215 WP_002029319.1.100479 WP_002029319.1.11324 WP_002029319.1.17940 WP_002029319.1.22507 WP_002029319.1.27138 WP_002029319.1.30061 WP_002029319.1.37649 WP_002029319.1.39896 WP_002029319.1.42272 WP_002029319.1.50487 WP_002029319.1.53672 WP_002029319.1.53916 WP_002029319.1.54007 WP_002029319.1.57105 WP_002029319.1.67742 WP_002029319.1.72824 WP_002029319.1.75300 WP_002029319.1.84520 WP_002029319.1.89564 WP_002029319.1.89932 WP_002029319.1.93582 WP_002029319.1.99044 gi|163938059|ref|YP_001642943.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]