SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938075|ref|YP_001642959.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938075|ref|YP_001642959.1|
Domain Number 1 Region: 2-241
Classification Level Classification E-value
Superfamily Hsp33 domain 3.01e-79
Family Hsp33 domain 0.00000007
Further Details:      
 
Domain Number 2 Region: 232-290
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 1.26e-18
Family HSP33 redox switch-like 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938075|ref|YP_001642959.1|
Sequence length 291
Comment Hsp33-like chaperonin [Bacillus weihenstephanensis KBAB4]
Sequence
MKDYLVKALAFNGEVRAYSVRTTNTVSEAQKRHDTWRTASAALGRSLTAGTMMGAMLKGE
QKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGKLRVYQAVGTEGFVTVI
KDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVLVNGDDSVLAAGGFILQI
MPGAQEETISFIEERLQQIPPVSQLIEQGLSPEELLYEVLGEDKVKVLETMDVQFNCTCS
RERIESVLISLGKAELEQIRAEEEETEVHCHFCNERHKFAKEDITSLIEKL
Download sequence
Identical sequences A0A084ITE7 A0A150C158 A0A1I6CD37 A0A243ARZ1 A9VN80 C2PPT9 C2SE06 J8C670 J8HMD4 J8J5E5 J8NWZ3 J8PZY7 R8EIQ1 R8HGG3 R8NQG0 W4F0R3
gi|163938075|ref|YP_001642959.1| 315730.BcerKBAB4_0062 WP_002009693.1.100646 WP_002009693.1.100649 WP_002009693.1.11324 WP_002009693.1.17940 WP_002009693.1.20051 WP_002009693.1.20881 WP_002009693.1.21695 WP_002009693.1.27729 WP_002009693.1.27732 WP_002009693.1.28299 WP_002009693.1.2902 WP_002009693.1.2904 WP_002009693.1.30061 WP_002009693.1.31050 WP_002009693.1.35095 WP_002009693.1.36226 WP_002009693.1.37635 WP_002009693.1.37801 WP_002009693.1.38645 WP_002009693.1.39255 WP_002009693.1.39896 WP_002009693.1.4354 WP_002009693.1.4496 WP_002009693.1.47674 WP_002009693.1.47957 WP_002009693.1.54007 WP_002009693.1.57105 WP_002009693.1.59016 WP_002009693.1.60236 WP_002009693.1.63476 WP_002009693.1.6426 WP_002009693.1.64566 WP_002009693.1.68186 WP_002009693.1.75292 WP_002009693.1.79293 WP_002009693.1.82832 WP_002009693.1.8290 WP_002009693.1.85012 WP_002009693.1.85187 WP_002009693.1.86789 WP_002009693.1.87416 WP_002009693.1.99558 WP_002009693.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]