SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938083|ref|YP_001642967.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938083|ref|YP_001642967.1|
Domain Number 1 Region: 4-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 7.24e-18
Family SinR domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938083|ref|YP_001642967.1|
Sequence length 67
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSPSQDFVVEVAKTLNVS
IDELMPK
Download sequence
Identical sequences A0A084ITF5 A0A150C169 A0A1I6CD53 A0A243ARW9 A0A2A7H0V0 A0A2A7K6M1 A0A2H3QH50 A9VN88 C2PPU6 J7VZG5 J7WW18 J8AVL0 J8C4A5 J8CGB9 J8EG60 J8HS71 J8ILB4 J8KXQ3 J8NG54 J8PWZ0 J9AL29 J9BHH1 R8CFM8 R8CMI8 R8EIK1 R8HGJ7 R8KSC8 R8NPV3 R8PUX6 W4F148
WP_002009706.1.100215 WP_002009706.1.10033 WP_002009706.1.100479 WP_002009706.1.100646 WP_002009706.1.100649 WP_002009706.1.10775 WP_002009706.1.11324 WP_002009706.1.17940 WP_002009706.1.20051 WP_002009706.1.20881 WP_002009706.1.21695 WP_002009706.1.22507 WP_002009706.1.23136 WP_002009706.1.27138 WP_002009706.1.27729 WP_002009706.1.27732 WP_002009706.1.28299 WP_002009706.1.2902 WP_002009706.1.2904 WP_002009706.1.30061 WP_002009706.1.31050 WP_002009706.1.35095 WP_002009706.1.36226 WP_002009706.1.37019 WP_002009706.1.37635 WP_002009706.1.37649 WP_002009706.1.37801 WP_002009706.1.38270 WP_002009706.1.38645 WP_002009706.1.39255 WP_002009706.1.39317 WP_002009706.1.39896 WP_002009706.1.42272 WP_002009706.1.4354 WP_002009706.1.4496 WP_002009706.1.45835 WP_002009706.1.46157 WP_002009706.1.47674 WP_002009706.1.47957 WP_002009706.1.50411 WP_002009706.1.50487 WP_002009706.1.52845 WP_002009706.1.53672 WP_002009706.1.53916 WP_002009706.1.54007 WP_002009706.1.57105 WP_002009706.1.59016 WP_002009706.1.60236 WP_002009706.1.63476 WP_002009706.1.6426 WP_002009706.1.64566 WP_002009706.1.65665 WP_002009706.1.66471 WP_002009706.1.67742 WP_002009706.1.68186 WP_002009706.1.68668 WP_002009706.1.72294 WP_002009706.1.72824 WP_002009706.1.72867 WP_002009706.1.73166 WP_002009706.1.75292 WP_002009706.1.75300 WP_002009706.1.76817 WP_002009706.1.79293 WP_002009706.1.82832 WP_002009706.1.8290 WP_002009706.1.84520 WP_002009706.1.84599 WP_002009706.1.85012 WP_002009706.1.85187 WP_002009706.1.86789 WP_002009706.1.87416 WP_002009706.1.89263 WP_002009706.1.89564 WP_002009706.1.89932 WP_002009706.1.93582 WP_002009706.1.99044 WP_002009706.1.99558 WP_002009706.1.99908 gi|163938083|ref|YP_001642967.1| 315730.BcerKBAB4_0070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]