SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938134|ref|YP_001643018.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938134|ref|YP_001643018.1|
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Translational machinery components 8.07e-56
Family Ribosomal protein L18 and S11 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938134|ref|YP_001643018.1|
Sequence length 120
Comment 50S ribosomal protein L18 [Bacillus weihenstephanensis KBAB4]
Sequence
MITKAAKNATRKKRHARVRAKLTGTAERPRLNVYRSNQHIYAQVIDDVNGVTLVSASTLD
KDLALNGTSNTEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHGRVKALAEAAREAGLQF
Download sequence
Identical sequences A0A084ITP2 A0A150C4U1 A0A1I6CDV9 A0A243AS89 A9VP93 C2PPZ6 C2SE79 C2XN92 J7VGV8 J7ZMV2 J8A5S0 J8BYR6 J8D8C6 J8FJC3 J8HI95 J8HXV6 J8IZA8 J8JX27 J8N7J6 J8PUH3 J9A8W0 J9B5I9 R8CFS3 R8CJT0 R8F2X0 R8GYP0 R8KW51 R8NPY2 R8R0S5 W4EVI2
WP_002009761.1.100215 WP_002009761.1.10033 WP_002009761.1.100479 WP_002009761.1.100646 WP_002009761.1.100649 WP_002009761.1.10775 WP_002009761.1.11324 WP_002009761.1.17940 WP_002009761.1.20051 WP_002009761.1.20881 WP_002009761.1.21695 WP_002009761.1.22507 WP_002009761.1.23136 WP_002009761.1.27138 WP_002009761.1.27729 WP_002009761.1.27732 WP_002009761.1.28299 WP_002009761.1.2902 WP_002009761.1.2904 WP_002009761.1.30061 WP_002009761.1.31050 WP_002009761.1.35095 WP_002009761.1.36226 WP_002009761.1.37019 WP_002009761.1.37635 WP_002009761.1.37649 WP_002009761.1.37801 WP_002009761.1.38270 WP_002009761.1.38645 WP_002009761.1.39255 WP_002009761.1.39317 WP_002009761.1.39896 WP_002009761.1.42272 WP_002009761.1.4354 WP_002009761.1.4496 WP_002009761.1.45835 WP_002009761.1.46157 WP_002009761.1.47674 WP_002009761.1.47957 WP_002009761.1.49911 WP_002009761.1.50411 WP_002009761.1.50487 WP_002009761.1.52845 WP_002009761.1.53672 WP_002009761.1.53916 WP_002009761.1.54007 WP_002009761.1.57105 WP_002009761.1.59016 WP_002009761.1.60236 WP_002009761.1.63476 WP_002009761.1.6426 WP_002009761.1.64566 WP_002009761.1.65665 WP_002009761.1.66471 WP_002009761.1.67742 WP_002009761.1.68186 WP_002009761.1.68668 WP_002009761.1.72294 WP_002009761.1.72824 WP_002009761.1.72867 WP_002009761.1.73166 WP_002009761.1.75292 WP_002009761.1.75300 WP_002009761.1.76817 WP_002009761.1.79293 WP_002009761.1.82832 WP_002009761.1.8290 WP_002009761.1.84520 WP_002009761.1.84599 WP_002009761.1.85012 WP_002009761.1.85187 WP_002009761.1.86789 WP_002009761.1.87416 WP_002009761.1.89263 WP_002009761.1.89564 WP_002009761.1.89932 WP_002009761.1.93582 WP_002009761.1.99044 WP_002009761.1.99558 WP_002009761.1.99908 gi|163938134|ref|YP_001643018.1| 315730.BcerKBAB4_0121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]