SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938144|ref|YP_001643028.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938144|ref|YP_001643028.1|
Domain Number 1 Region: 14-129
Classification Level Classification E-value
Superfamily Translational machinery components 1.11e-49
Family Ribosomal protein L18 and S11 0.00000864
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938144|ref|YP_001643028.1|
Sequence length 129
Comment 30S ribosomal protein S11 [Bacillus weihenstephanensis KBAB4]
Sequence
MARKTNTRKKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWSSAGALGFRGSRKSTP
FAAQMAAEAASKVAMEHGLKTLEVTVKGPGAGREAAIRALQAAGLEVTAIRDVTPVPHNG
CRPPKRRRV
Download sequence
Identical sequences A0A073K5J8 A0A084ITQ2 A0A150C4T0 A0A1I6CDX8 A0A243AS84 A0A2B5Y0Y1 A9VPA3 C2PQ06 C2SE89 C2XN29 J7VGW7 J7ZMU2 J8A5Q8 J8BYS6 J8D8D6 J8FJB4 J8HIA5 J8HXU6 J8IZ99 J8JX37 J8N7I9 J8PUG7 J9A8W7 J9B5I2 R8CFT4 R8CJU0 R8F2Y1 R8GYQ0 R8KW40 R8NQ06 R8R0T5 W4EVH1
gi|163938144|ref|YP_001643028.1| 315730.BcerKBAB4_0131 WP_002009745.1.100215 WP_002009745.1.10033 WP_002009745.1.100479 WP_002009745.1.100646 WP_002009745.1.100649 WP_002009745.1.10775 WP_002009745.1.11324 WP_002009745.1.17940 WP_002009745.1.20051 WP_002009745.1.20881 WP_002009745.1.21695 WP_002009745.1.22507 WP_002009745.1.23136 WP_002009745.1.27138 WP_002009745.1.27729 WP_002009745.1.27732 WP_002009745.1.28299 WP_002009745.1.2902 WP_002009745.1.2904 WP_002009745.1.30061 WP_002009745.1.31050 WP_002009745.1.35095 WP_002009745.1.36226 WP_002009745.1.37019 WP_002009745.1.37635 WP_002009745.1.37649 WP_002009745.1.37801 WP_002009745.1.38270 WP_002009745.1.38645 WP_002009745.1.39255 WP_002009745.1.39317 WP_002009745.1.39896 WP_002009745.1.42272 WP_002009745.1.4354 WP_002009745.1.4496 WP_002009745.1.45835 WP_002009745.1.46157 WP_002009745.1.47674 WP_002009745.1.47957 WP_002009745.1.48633 WP_002009745.1.49911 WP_002009745.1.50411 WP_002009745.1.50487 WP_002009745.1.52845 WP_002009745.1.53672 WP_002009745.1.53916 WP_002009745.1.54007 WP_002009745.1.57105 WP_002009745.1.59016 WP_002009745.1.60236 WP_002009745.1.63476 WP_002009745.1.6426 WP_002009745.1.64566 WP_002009745.1.65665 WP_002009745.1.66471 WP_002009745.1.67742 WP_002009745.1.68186 WP_002009745.1.68668 WP_002009745.1.72294 WP_002009745.1.72824 WP_002009745.1.72867 WP_002009745.1.72875 WP_002009745.1.73166 WP_002009745.1.75292 WP_002009745.1.75300 WP_002009745.1.76817 WP_002009745.1.79293 WP_002009745.1.82832 WP_002009745.1.8290 WP_002009745.1.84520 WP_002009745.1.84599 WP_002009745.1.85012 WP_002009745.1.85187 WP_002009745.1.86789 WP_002009745.1.87416 WP_002009745.1.89263 WP_002009745.1.89564 WP_002009745.1.89932 WP_002009745.1.93582 WP_002009745.1.99044 WP_002009745.1.99558 WP_002009745.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]