SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938199|ref|YP_001643083.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938199|ref|YP_001643083.1|
Domain Number 1 Region: 144-293
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.49e-18
Family Phosphate binding protein-like 0.012
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000787
Family Terminase gpNU1 subunit domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938199|ref|YP_001643083.1|
Sequence length 306
Comment DNA binding domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MDHHSYTTEEVAMQLKVSKLTVYDLIKKGELPSYRVGRQMRIDAADLEQYIKQMKTGKVQ
FTPVKKDEISSSNTRIISGQELTLDMLAKHIENRLPNSNILRAYQGSLTSLVKMYQGEGS
VVSLHLFDGETGTYNVPYVKRILVGQPYIMMNLLARNVGFYVQKGNPQNIKTWADLAQSS
IRFVNREKGSGIRVLVDEQLRIRKLSKEDINGYEWEESNHLGVASQVANGKADVGVGSEK
FSQIVNVDFIPIMKEQYDLVLLKNKENEELIEVIKGILQSEEFHNELKAIGGYDISKTGQ
IIYETN
Download sequence
Identical sequences A9VQA9
gi|163938199|ref|YP_001643083.1| 315730.BcerKBAB4_0187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]