SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938242|ref|YP_001643126.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938242|ref|YP_001643126.1|
Domain Number 1 Region: 14-250
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.18e-62
Family Alanine racemase-like, N-terminal domain 0.000000451
Further Details:      
 
Domain Number 2 Region: 244-385
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.26e-48
Family Alanine racemase 0.00000368
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938242|ref|YP_001643126.1|
Sequence length 389
Comment alanine racemase [Bacillus weihenstephanensis KBAB4]
Sequence
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKANAYGHDYVPVAKTALEAG
ATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDVNVAAENDVALTVFQKEWVEDAIKLW
DGSSIMKFHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELEGVYTHFATSDEVETSYF
DKQYNTFLQQLSWLKEFGVNPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTRTEEWIATVAIGYADGWLRRLQGF
KVLVNGERVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IIATISFRVPRIFIRHGKVVEVINYLNDI
Download sequence
Identical sequences A9VQF2 C2PQA2 J8DGL7 J8HJ58 R8GZ79
WP_002009971.1.17940 WP_002009971.1.28299 WP_002009971.1.79293 WP_002009971.1.85012 WP_002009971.1.99908 gi|163938242|ref|YP_001643126.1| 315730.BcerKBAB4_0230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]