SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938329|ref|YP_001643213.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938329|ref|YP_001643213.1|
Domain Number 1 Region: 112-363
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.47e-69
Family D-glucarate dehydratase-like 0.0000153
Further Details:      
 
Domain Number 2 Region: 1-125
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.11e-36
Family Enolase N-terminal domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938329|ref|YP_001643213.1|
Sequence length 369
Comment mandelate racemase/muconate lactonizing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKITAIHLYAIRLPLRDPFVISYGSYSDMPSIIVKMETDEGIIGYGEGVADDHVTGESWE
STFHVLKHTLAPALIGKNPMNIEKVHDMMDNTIYSVPTAKAAIDIACFDIMGKKLNQPVY
QLIGGRYHEEFPVTHVLSIAEPENMAEEAASMIQKGYQSFKMKVGTNVKEDVKRIEAVRE
RVGNDIAIRVDVNQGWQNSANTLTALRSLGHLNIDWIEQPVVADDIDAMAHIRSKTDIPL
MIDEGLKGSREMRQIIKLDAADKVNIKLMKCGGIYPAVKLAHQAEMAGIECQVGSMVESS
VASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPFIRLNEKPGLGIEINENILQE
LTVFQDVVR
Download sequence
Identical sequences A9VRJ5
gi|163938329|ref|YP_001643213.1| 315730.BcerKBAB4_0319 WP_012260242.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]