SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938423|ref|YP_001643307.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938423|ref|YP_001643307.1|
Domain Number 1 Region: 7-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000163
Family SinR domain-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938423|ref|YP_001643307.1|
Sequence length 217
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MPNGNPNERLGKLIKKLLKERALSMRQLGTLTNIDPATISRIINGKQQPKQNHLQKFANC
LQVPPQLLLDEMYPNSPHINKEKADMYTSLDTIQQTLQSSNLFDFEYTTTRVKQELENYE
RYAQTTEGEKRIHESFKSKIEQIDSAGPFIEQLTNMYQQFCTETISTEERAIIGGALLYF
ILSTDIIPDYLFPIGYLDDAIAVELAKEKLIEIKRKT
Download sequence
Identical sequences A0A0A0X003 A0A150C594 A0A1I6BP78 A9VSP3 C2SF09 J8CPK8 J8MRM6 J8NDJ2 J8PEY5 R8F1L5 R8GZZ1 R8NKI4 W4F0W0
gi|163938423|ref|YP_001643307.1| WP_002029602.1.100646 WP_002029602.1.100649 WP_002029602.1.17940 WP_002029602.1.20051 WP_002029602.1.20881 WP_002029602.1.27729 WP_002029602.1.27732 WP_002029602.1.2902 WP_002029602.1.2904 WP_002029602.1.30061 WP_002029602.1.35095 WP_002029602.1.36226 WP_002029602.1.37635 WP_002029602.1.37801 WP_002029602.1.39255 WP_002029602.1.4354 WP_002029602.1.4496 WP_002029602.1.46157 WP_002029602.1.47674 WP_002029602.1.47957 WP_002029602.1.54007 WP_002029602.1.57105 WP_002029602.1.59016 WP_002029602.1.60236 WP_002029602.1.63476 WP_002029602.1.68186 WP_002029602.1.72867 WP_002029602.1.75292 WP_002029602.1.82832 WP_002029602.1.8290 WP_002029602.1.85012 WP_002029602.1.85187 WP_002029602.1.87416 WP_002029602.1.99558 WP_002029602.1.99908 315730.BcerKBAB4_0413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]