SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938513|ref|YP_001643397.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|163938513|ref|YP_001643397.1|
Domain Number - Region: 42-149
Classification Level Classification E-value
Superfamily FliG 0.0259
Family FliG 0.012
Further Details:      
 
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily Stathmin 0.0837
Family Stathmin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938513|ref|YP_001643397.1|
Sequence length 160
Comment hypothetical protein BcerKBAB4_0503 [Bacillus weihenstephanensis KBAB4]
Sequence
MAKEITLIKKKIVTEEEKKQQVTDELLNDLAENREAVEETMQLLAQLQKAGILDAAISLL
AAKEDVSKIAVEQLNREPVKNALNNMMGAGEALSSVDPEITKQITSSLVTGLQFATEELN
SGKKTKVMDFFKVLKDPDINRAITFGFSFLKAFGQGLEKK
Download sequence
Identical sequences A0A084IYY4 A0A150CF72 A9VTS3 J8DE30 J8P260 J8PIW9 R8HPN7 R8NJX1 W4DXF5
WP_002140332.1.10033 WP_002140332.1.100649 WP_002140332.1.17940 WP_002140332.1.27732 WP_002140332.1.35095 WP_002140332.1.36226 WP_002140332.1.37635 WP_002140332.1.38645 WP_002140332.1.46157 WP_002140332.1.47674 WP_002140332.1.47957 WP_002140332.1.54007 WP_002140332.1.59016 WP_002140332.1.60236 WP_002140332.1.85012 WP_002140332.1.86789 WP_002140332.1.93582 WP_002140332.1.99908 gi|163938513|ref|YP_001643397.1| 315730.BcerKBAB4_0503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]