SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938602|ref|YP_001643486.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938602|ref|YP_001643486.1|
Domain Number 1 Region: 20-263
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.34e-19
Family Alanine racemase-like, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938602|ref|YP_001643486.1|
Sequence length 390
Comment hypothetical protein BcerKBAB4_0593 [Bacillus weihenstephanensis KBAB4]
Sequence
MDRGIFKEVPLPCAFLDEVALERNIQSIIELSGDKKIRIASKSLRSVPIMKKILAANNRF
QGIMCFSPREALFLIEQGFNDLLLGYPVYDERALHEISLLTKQGHIITCMVDCEDHITYL
EKIAEKSKGCFRVCLDIDMSSRFLKFHFGVKRSPVKDVQSALKIVEKVKGSSYLILDGVM
GYEAQIAGVGDHIPNQWMKSKAVSYLKKKSVLEVKERRERIVKEIQNLGIELRFVNGGGT
GSIKTTEQDNSVSEITVGSGFYSPKLFDYYKEVKFQPAAGFALPVVRKPDPFIYTCLGGG
YIASGAVGKDKEPEVWMPHGAKLLALEGAGEVQTPIFYNGEERVDIGDSILFRHSKAGEL
CERFPILYRIKQGEIVGEYSTYRGDGQCFL
Download sequence
Identical sequences A9VEV9
WP_012260318.1.99908 315730.BcerKBAB4_0593 gi|163938602|ref|YP_001643486.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]