SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938609|ref|YP_001643493.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938609|ref|YP_001643493.1|
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.42e-16
Family SinR domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163938609|ref|YP_001643493.1|
Sequence length 72
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MTICNKVKELRARFNFTQSVLAEKVGVTRQTIAAIEKGDYVPSLLLALTICDVFELKMED
VFVLNKEGEEDE
Download sequence
Identical sequences A0A084IZ69 A0A150C2F5 A0A1I6BK51 A9VEW6 J7VYQ7 J8D4V0 J8IBB5 J9CX36 R8CJ62 R8F0I7 R8HP22
WP_002090910.1.100646 315730.BcerKBAB4_0600 gi|163938609|ref|YP_001643493.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]