SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938619|ref|YP_001643503.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938619|ref|YP_001643503.1|
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.36e-19
Family SinR domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938619|ref|YP_001643503.1|
Sequence length 66
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MAVSKIKVARVQLDLTQQQLAEKVGVTRQTISLIEKGKYNPSLDLCLKICYAVDKTLNDL
FWEEKE
Download sequence
Identical sequences A0A084IZ79 A0A0F5RTM6 A0A0G8D068 A0A0J1KGI3 A0A0K6N1Z8 A0A0S3BSG4 A0A0T8JI10 A0A154AVP9 A0A158RMZ6 A0A1H5ZTH9 A0A1I4MSE7 A0A1I6BJT4 A0A1J9YYR7 A0A1J9ZJC5 A0A1K0AKL4 A0A1K0ALC2 A0A1M6NPC1 A0A1V9W116 A0A229M8E6 A0A229MJG7 A0A242XE39 A0A242XXA4 A0A243AK33 A0A243BLC5 A0A243DYU6 A0A243EE93 A0A243FT42 A0A243GB87 A0A243I1S2 A0A243K6G0 A0A246UMX8 A0A2A7E652 A0A2A9HJ73 A0A2B4FGW6 A0A2C4QQX1 A0A2C5BDP4 A0A2G6Q9N7 A0A2K1RYP6 A0R9X7 A9VEX6 B3ZG26 B3ZV83 B7HWB7 B7JQH8 B9J4Y7 C2MG99 C2ND54 C2PRE5 C2RZ61 C2SFJ2 C2SWE6 C2TBZ5 C2U9G7 C2VP51 C2XPI8 D8H1W9 J7VYQ0 J8BSF8 J8D4V9 J8FN45 J8G7N7 J8HI36 J8IBA6 J8J4F6 J8J6L0 J8L2I3 J8MXD5 J8NKE2 J8PDK9 J8PU54 J8ZSN3 J9BAS5 J9CX47 Q63FV0 Q6HNC0 Q73DE8 Q81HU1 Q81V09 R8CJ72 R8CQY7 R8F0M0 R8GYJ4 R8HP13 R8LBJ2 R8NKV4 S3I6Z9 W4DXQ6
gi|301052344|ref|YP_003790555.1| gi|30260845|ref|NP_843222.1| gi|222094450|ref|YP_002528509.1| gi|49476873|ref|YP_034951.1| NP_830503.1.86172 NP_843222.1.87267 WP_000301182.1.100095 WP_000301182.1.100214 WP_000301182.1.100215 WP_000301182.1.10033 WP_000301182.1.100595 WP_000301182.1.100646 WP_000301182.1.100649 WP_000301182.1.100873 WP_000301182.1.100912 WP_000301182.1.101550 WP_000301182.1.101720 WP_000301182.1.101843 WP_000301182.1.101931 WP_000301182.1.10208 WP_000301182.1.10762 WP_000301182.1.11044 WP_000301182.1.11060 WP_000301182.1.11387 WP_000301182.1.11427 WP_000301182.1.11521 WP_000301182.1.11676 WP_000301182.1.12289 WP_000301182.1.12751 WP_000301182.1.13024 WP_000301182.1.13115 WP_000301182.1.13221 WP_000301182.1.13233 WP_000301182.1.13299 WP_000301182.1.13820 WP_000301182.1.14176 WP_000301182.1.14721 WP_000301182.1.14855 WP_000301182.1.14882 WP_000301182.1.15163 WP_000301182.1.15460 WP_000301182.1.15569 WP_000301182.1.16013 WP_000301182.1.16156 WP_000301182.1.16170 WP_000301182.1.16199 WP_000301182.1.16997 WP_000301182.1.17146 WP_000301182.1.17408 WP_000301182.1.17424 WP_000301182.1.17899 WP_000301182.1.17927 WP_000301182.1.17940 WP_000301182.1.1850 WP_000301182.1.18840 WP_000301182.1.18976 WP_000301182.1.19173 WP_000301182.1.19258 WP_000301182.1.19435 WP_000301182.1.19438 WP_000301182.1.19445 WP_000301182.1.20051 WP_000301182.1.20208 WP_000301182.1.20390 WP_000301182.1.20651 WP_000301182.1.20665 WP_000301182.1.20680 WP_000301182.1.20687 WP_000301182.1.20865 WP_000301182.1.20881 WP_000301182.1.21021 WP_000301182.1.21258 WP_000301182.1.21643 WP_000301182.1.21695 WP_000301182.1.21776 WP_000301182.1.22084 WP_000301182.1.22507 WP_000301182.1.22865 WP_000301182.1.23100 WP_000301182.1.23110 WP_000301182.1.23136 WP_000301182.1.23200 WP_000301182.1.23269 WP_000301182.1.23873 WP_000301182.1.24184 WP_000301182.1.2419 WP_000301182.1.24334 WP_000301182.1.24377 WP_000301182.1.24556 WP_000301182.1.24608 WP_000301182.1.24676 WP_000301182.1.24709 WP_000301182.1.24759 WP_000301182.1.25316 WP_000301182.1.25505 WP_000301182.1.25599 WP_000301182.1.2569 WP_000301182.1.25716 WP_000301182.1.25752 WP_000301182.1.25757 WP_000301182.1.26000 WP_000301182.1.2618 WP_000301182.1.26499 WP_000301182.1.26637 WP_000301182.1.26665 WP_000301182.1.26721 WP_000301182.1.27138 WP_000301182.1.27334 WP_000301182.1.27644 WP_000301182.1.27729 WP_000301182.1.27732 WP_000301182.1.27987 WP_000301182.1.28299 WP_000301182.1.28427 WP_000301182.1.28729 WP_000301182.1.2902 WP_000301182.1.2904 WP_000301182.1.29101 WP_000301182.1.29209 WP_000301182.1.29451 WP_000301182.1.29787 WP_000301182.1.29804 WP_000301182.1.30061 WP_000301182.1.30091 WP_000301182.1.30110 WP_000301182.1.30216 WP_000301182.1.30336 WP_000301182.1.31050 WP_000301182.1.31490 WP_000301182.1.31685 WP_000301182.1.3236 WP_000301182.1.32522 WP_000301182.1.32576 WP_000301182.1.32927 WP_000301182.1.33045 WP_000301182.1.33061 WP_000301182.1.33175 WP_000301182.1.3318 WP_000301182.1.33201 WP_000301182.1.33338 WP_000301182.1.33367 WP_000301182.1.33740 WP_000301182.1.33828 WP_000301182.1.33876 WP_000301182.1.34158 WP_000301182.1.34646 WP_000301182.1.35095 WP_000301182.1.35255 WP_000301182.1.35684 WP_000301182.1.35886 WP_000301182.1.3615 WP_000301182.1.36226 WP_000301182.1.36305 WP_000301182.1.36763 WP_000301182.1.3699 WP_000301182.1.37019 WP_000301182.1.37093 WP_000301182.1.37635 WP_000301182.1.37649 WP_000301182.1.37801 WP_000301182.1.37990 WP_000301182.1.38036 WP_000301182.1.38270 WP_000301182.1.38425 WP_000301182.1.38645 WP_000301182.1.39001 WP_000301182.1.3925 WP_000301182.1.39255 WP_000301182.1.39317 WP_000301182.1.39781 WP_000301182.1.40550 WP_000301182.1.40818 WP_000301182.1.41083 WP_000301182.1.41165 WP_000301182.1.41365 WP_000301182.1.41464 WP_000301182.1.41518 WP_000301182.1.41675 WP_000301182.1.41976 WP_000301182.1.42165 WP_000301182.1.42272 WP_000301182.1.42747 WP_000301182.1.43104 WP_000301182.1.43533 WP_000301182.1.4354 WP_000301182.1.43762 WP_000301182.1.4439 WP_000301182.1.44463 WP_000301182.1.4447 WP_000301182.1.44483 WP_000301182.1.4496 WP_000301182.1.45089 WP_000301182.1.45305 WP_000301182.1.45385 WP_000301182.1.45533 WP_000301182.1.45835 WP_000301182.1.45919 WP_000301182.1.46157 WP_000301182.1.46236 WP_000301182.1.46244 WP_000301182.1.46476 WP_000301182.1.4649 WP_000301182.1.46549 WP_000301182.1.46699 WP_000301182.1.46746 WP_000301182.1.47097 WP_000301182.1.47145 WP_000301182.1.47441 WP_000301182.1.4763 WP_000301182.1.47644 WP_000301182.1.47674 WP_000301182.1.47798 WP_000301182.1.47957 WP_000301182.1.48010 WP_000301182.1.48164 WP_000301182.1.48311 WP_000301182.1.48599 WP_000301182.1.4865 WP_000301182.1.49056 WP_000301182.1.49428 WP_000301182.1.49802 WP_000301182.1.49831 WP_000301182.1.50316 WP_000301182.1.50411 WP_000301182.1.50487 WP_000301182.1.50514 WP_000301182.1.50770 WP_000301182.1.51072 WP_000301182.1.51087 WP_000301182.1.51167 WP_000301182.1.51656 WP_000301182.1.51749 WP_000301182.1.52756 WP_000301182.1.52794 WP_000301182.1.52845 WP_000301182.1.53137 WP_000301182.1.53493 WP_000301182.1.53672 WP_000301182.1.53683 WP_000301182.1.53879 WP_000301182.1.53916 WP_000301182.1.54007 WP_000301182.1.54117 WP_000301182.1.54189 WP_000301182.1.54775 WP_000301182.1.54782 WP_000301182.1.55057 WP_000301182.1.55116 WP_000301182.1.55811 WP_000301182.1.55958 WP_000301182.1.56042 WP_000301182.1.56055 WP_000301182.1.56176 WP_000301182.1.56270 WP_000301182.1.5628 WP_000301182.1.56318 WP_000301182.1.56959 WP_000301182.1.57105 WP_000301182.1.57203 WP_000301182.1.57245 WP_000301182.1.57565 WP_000301182.1.57815 WP_000301182.1.57859 WP_000301182.1.58037 WP_000301182.1.58160 WP_000301182.1.58328 WP_000301182.1.58814 WP_000301182.1.58822 WP_000301182.1.59016 WP_000301182.1.59052 WP_000301182.1.59095 WP_000301182.1.59173 WP_000301182.1.59310 WP_000301182.1.59575 WP_000301182.1.59773 WP_000301182.1.59978 WP_000301182.1.59997 WP_000301182.1.60012 WP_000301182.1.60153 WP_000301182.1.60236 WP_000301182.1.60274 WP_000301182.1.60402 WP_000301182.1.61213 WP_000301182.1.61231 WP_000301182.1.61820 WP_000301182.1.61919 WP_000301182.1.61944 WP_000301182.1.62300 WP_000301182.1.62918 WP_000301182.1.62978 WP_000301182.1.6304 WP_000301182.1.63137 WP_000301182.1.63476 WP_000301182.1.63560 WP_000301182.1.6426 WP_000301182.1.64377 WP_000301182.1.64491 WP_000301182.1.64566 WP_000301182.1.64706 WP_000301182.1.65515 WP_000301182.1.65665 WP_000301182.1.65758 WP_000301182.1.65983 WP_000301182.1.66331 WP_000301182.1.66357 WP_000301182.1.67001 WP_000301182.1.6716 WP_000301182.1.67742 WP_000301182.1.67912 WP_000301182.1.68186 WP_000301182.1.6846 WP_000301182.1.68562 WP_000301182.1.68607 WP_000301182.1.68668 WP_000301182.1.69203 WP_000301182.1.69323 WP_000301182.1.69347 WP_000301182.1.69822 WP_000301182.1.69894 WP_000301182.1.69970 WP_000301182.1.70018 WP_000301182.1.70065 WP_000301182.1.70645 WP_000301182.1.7096 WP_000301182.1.70996 WP_000301182.1.71114 WP_000301182.1.71648 WP_000301182.1.71895 WP_000301182.1.71953 WP_000301182.1.72294 WP_000301182.1.72514 WP_000301182.1.72704 WP_000301182.1.72752 WP_000301182.1.72824 WP_000301182.1.72867 WP_000301182.1.72912 WP_000301182.1.73325 WP_000301182.1.73329 WP_000301182.1.73396 WP_000301182.1.74226 WP_000301182.1.74538 WP_000301182.1.75292 WP_000301182.1.75300 WP_000301182.1.7545 WP_000301182.1.75499 WP_000301182.1.75870 WP_000301182.1.75942 WP_000301182.1.76125 WP_000301182.1.76783 WP_000301182.1.76817 WP_000301182.1.76902 WP_000301182.1.77370 WP_000301182.1.77402 WP_000301182.1.77576 WP_000301182.1.77668 WP_000301182.1.77690 WP_000301182.1.77824 WP_000301182.1.77902 WP_000301182.1.782 WP_000301182.1.7856 WP_000301182.1.78644 WP_000301182.1.79043 WP_000301182.1.79250 WP_000301182.1.79252 WP_000301182.1.79293 WP_000301182.1.79315 WP_000301182.1.79584 WP_000301182.1.79658 WP_000301182.1.79687 WP_000301182.1.80126 WP_000301182.1.80239 WP_000301182.1.80439 WP_000301182.1.80571 WP_000301182.1.80649 WP_000301182.1.80695 WP_000301182.1.80955 WP_000301182.1.81088 WP_000301182.1.81799 WP_000301182.1.82289 WP_000301182.1.82421 WP_000301182.1.82533 WP_000301182.1.82832 WP_000301182.1.8290 WP_000301182.1.82986 WP_000301182.1.83070 WP_000301182.1.83951 WP_000301182.1.84045 WP_000301182.1.84337 WP_000301182.1.84520 WP_000301182.1.85012 WP_000301182.1.85187 WP_000301182.1.85592 WP_000301182.1.85689 WP_000301182.1.86082 WP_000301182.1.86119 WP_000301182.1.86140 WP_000301182.1.86239 WP_000301182.1.86288 WP_000301182.1.86637 WP_000301182.1.86763 WP_000301182.1.86789 WP_000301182.1.8698 WP_000301182.1.87416 WP_000301182.1.87627 WP_000301182.1.88154 WP_000301182.1.88200 WP_000301182.1.8825 WP_000301182.1.88641 WP_000301182.1.8923 WP_000301182.1.89263 WP_000301182.1.89325 WP_000301182.1.89460 WP_000301182.1.89564 WP_000301182.1.89675 WP_000301182.1.89932 WP_000301182.1.90452 WP_000301182.1.90596 WP_000301182.1.90671 WP_000301182.1.90791 WP_000301182.1.90883 WP_000301182.1.91080 WP_000301182.1.91367 WP_000301182.1.91404 WP_000301182.1.91569 WP_000301182.1.91615 WP_000301182.1.9186 WP_000301182.1.92347 WP_000301182.1.92620 WP_000301182.1.92686 WP_000301182.1.9269 WP_000301182.1.92831 WP_000301182.1.93271 WP_000301182.1.93582 WP_000301182.1.93744 WP_000301182.1.93893 WP_000301182.1.93927 WP_000301182.1.93932 WP_000301182.1.94237 WP_000301182.1.94322 WP_000301182.1.94784 WP_000301182.1.95308 WP_000301182.1.95457 WP_000301182.1.95484 WP_000301182.1.95786 WP_000301182.1.96356 WP_000301182.1.96437 WP_000301182.1.96934 WP_000301182.1.97149 WP_000301182.1.97617 WP_000301182.1.97781 WP_000301182.1.97842 WP_000301182.1.97861 WP_000301182.1.98216 WP_000301182.1.98604 WP_000301182.1.99044 WP_000301182.1.99266 WP_000301182.1.99445 WP_000301182.1.99454 WP_000301182.1.99485 WP_000301182.1.99558 WP_000301182.1.99908 WP_000301182.1.99994 YP_026938.1.16718 YP_034951.1.62562 gi|227816434|ref|YP_002816443.1| gi|402553774|ref|YP_006595045.1| gi|296501446|ref|YP_003663146.1| gi|49183686|ref|YP_026938.1| gi|375282767|ref|YP_005103204.1| 198094.BA_0695 222523.BCE_0764 226900.BC0690 260799.BAS0661 261594.GBAA0695 281309.BT9727_0605 288681.BCZK0606 315730.BcerKBAB4_0610 361100.BCQ_0764 405534.BCAH187_A0823 405535.BCAH820_0750 412694.BALH_0634 568206.BAMEG_3891 572264.BCA_0732 592021.BAA_0778 gi|376264659|ref|YP_005117371.1| gi|218901889|ref|YP_002449723.1| gi|118476376|ref|YP_893527.1| gi|30018872|ref|NP_830503.1| gi|229602348|ref|YP_002865290.1| gi|225862672|ref|YP_002748050.1| gi|52144616|ref|YP_082212.1| gi|42779842|ref|NP_977089.1| gi|163938619|ref|YP_001643503.1| gi|47525976|ref|YP_017325.1| gi|217958280|ref|YP_002336826.1| gi|386734539|ref|YP_006207720.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]