SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938638|ref|YP_001643522.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938638|ref|YP_001643522.1|
Domain Number 1 Region: 10-76
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 9.16e-18
Family FeoA-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938638|ref|YP_001643522.1|
Sequence length 85
Comment FeoA family protein [Bacillus weihenstephanensis KBAB4]
Sequence
MVSANTKPLSEFRTGEFVQIEKIQLEGTMKRRLLDLGFFPGATIKVLQRSPLGDPVAYQV
SNTTIALRSEESSLIFGVLIGDDFR
Download sequence
Identical sequences A0A084IZ98 A0A1I6BJD6 A0A1S9SA79 A0A243AK08 A9VEZ5 J7T2U7 J8CFW9 J8CP95 J8EYP3 J8HNT2 J8NHU6 J9A5N7 R8F0K5 R8HNW4 R8LB66 R8NK95 R8QXT2 W4DXT0
gi|163938638|ref|YP_001643522.1| 315730.BcerKBAB4_0630 WP_002090873.1.100215 WP_002090873.1.10033 WP_002090873.1.100479 WP_002090873.1.100646 WP_002090873.1.100649 WP_002090873.1.10775 WP_002090873.1.17940 WP_002090873.1.20051 WP_002090873.1.20881 WP_002090873.1.21695 WP_002090873.1.23136 WP_002090873.1.27138 WP_002090873.1.27729 WP_002090873.1.27732 WP_002090873.1.2902 WP_002090873.1.2904 WP_002090873.1.30061 WP_002090873.1.35095 WP_002090873.1.36226 WP_002090873.1.37635 WP_002090873.1.37801 WP_002090873.1.38270 WP_002090873.1.38645 WP_002090873.1.39255 WP_002090873.1.42272 WP_002090873.1.4354 WP_002090873.1.4496 WP_002090873.1.47957 WP_002090873.1.50487 WP_002090873.1.52845 WP_002090873.1.53672 WP_002090873.1.53916 WP_002090873.1.57105 WP_002090873.1.59016 WP_002090873.1.60236 WP_002090873.1.63476 WP_002090873.1.6426 WP_002090873.1.64566 WP_002090873.1.65665 WP_002090873.1.67742 WP_002090873.1.68186 WP_002090873.1.72824 WP_002090873.1.72867 WP_002090873.1.75292 WP_002090873.1.75300 WP_002090873.1.82832 WP_002090873.1.8290 WP_002090873.1.84520 WP_002090873.1.84599 WP_002090873.1.85012 WP_002090873.1.85187 WP_002090873.1.87416 WP_002090873.1.89263 WP_002090873.1.89564 WP_002090873.1.89932 WP_002090873.1.99558 WP_002090873.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]