SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938693|ref|YP_001643577.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938693|ref|YP_001643577.1|
Domain Number 1 Region: 122-356
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.33e-41
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.012
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.4e-19
Family Single-domain sulfurtransferase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938693|ref|YP_001643577.1|
Sequence length 378
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MSVKLLQAKDVAEKVLFGELFILDVRNETDYEDWKIEGKQVSSINKPYFDLLDGVDHIVD
ELPREKEILVVCAKEGSSQFVAEQLLHAGFNDVYYLAGGMKAWSEYVKPLKVGDVQGGGS
VYQFNRLGKGCLSYMIVSNGEAAVIDAIRTVEAYEDFAEEHGVTITNVMDTHLHADHISG
GRRLAEKVGGTYWLPPKDAEEVVFSYKPLVEGSVITVGGTKIEIDALYSPGHTIGSTSFI
VDDSYLLSGDILFVDSIGRPDLAGKAEDWVGDLRNTLYKRYKELSQDLIVLPAHYSKISE
MDDRGIVSAHLQDLFKENVGLNIADEVEFRKTVTENLPPQPNAYEEIRQTNMGKIYPSVE
EEREMEIGPNRCAVHDSL
Download sequence
Identical sequences A9VFQ3
WP_012260358.1.99908 gi|163938693|ref|YP_001643577.1| 315730.BcerKBAB4_0687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]