SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938707|ref|YP_001643591.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938707|ref|YP_001643591.1|
Domain Number 1 Region: 5-99
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.07e-34
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163938707|ref|YP_001643591.1|
Sequence length 106
Comment phosphotransferase system PTS lactose/cellobiose-specific IIA subunit [Bacillus weihenstephanensis KBAB4]
Sequence
MTDMQTPFALILHGGNARSAALEAIAFARQGDFENASEKMTLASEEISAAHRIQTDLIQE
EARGNHAEISLLLVHAQDHLMNAITVKELAEEFITLHKRVEEKVTV
Download sequence
Identical sequences A0A0J7A0C7 A0A1A9PZ55 A0A1C3T514 A0A1E8AXU2 A0A243MV27 A9VFR7 J8CN85 J8D6W9
gi|163938707|ref|YP_001643591.1| WP_000131328.1.100649 WP_000131328.1.10775 WP_000131328.1.17265 WP_000131328.1.1907 WP_000131328.1.23427 WP_000131328.1.27140 WP_000131328.1.30788 WP_000131328.1.3130 WP_000131328.1.31387 WP_000131328.1.37027 WP_000131328.1.42237 WP_000131328.1.47095 WP_000131328.1.473 WP_000131328.1.47957 WP_000131328.1.52932 WP_000131328.1.56549 WP_000131328.1.59016 WP_000131328.1.59075 WP_000131328.1.61481 WP_000131328.1.67283 WP_000131328.1.71142 WP_000131328.1.72554 WP_000131328.1.74901 WP_000131328.1.75554 WP_000131328.1.76342 WP_000131328.1.78264 WP_000131328.1.83206 WP_000131328.1.85012 WP_000131328.1.8759 WP_000131328.1.99908 315730.BcerKBAB4_0702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]