SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163938736|ref|YP_001643620.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938736|ref|YP_001643620.1|
Domain Number 1 Region: 98-269
Classification Level Classification E-value
Superfamily SIS domain 3.27e-43
Family mono-SIS domain 0.013
Further Details:      
 
Domain Number 2 Region: 5-77
Classification Level Classification E-value
Superfamily Homeodomain-like 4.66e-18
Family RpiR-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163938736|ref|YP_001643620.1|
Sequence length 287
Comment RpiR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MKASTLLFKIESNMDQFSPAEKKVAMYIMENAEIVPNLTTKEVSTNAGASEASVVRFCKS
IGIGSFKAFKIALVRELTIADYNINDFSVMNTEDGPYDLFNKVTYVNKAAIEASVTAIDK
KELEKAADRIVNADKIIFYGVGGSATPAMDGAYKFTRLGFTAMMLSDFHMMLPLVTNLKE
GDIFVAISTSGRTKDVLEMAQYAKKRGATVIAITKLDQSSPLYKAADIRLCMPDVEQDHR
IASIASRMTQLNMIDALYVITFNRIGNKVLDQFMETREEALRLRKLK
Download sequence
Identical sequences A0A0A0WQR9 A9VGE6 C2SFW6 J8DCP4 R8HQU5
315730.BcerKBAB4_0731 gi|163938736|ref|YP_001643620.1| WP_002029960.1.100649 WP_002029960.1.17940 WP_002029960.1.30061 WP_002029960.1.31050 WP_002029960.1.4496 WP_002029960.1.57105 WP_002029960.1.85012 WP_002029960.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]