SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938771|ref|YP_001643655.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938771|ref|YP_001643655.1|
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.57e-34
Family YheA-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938771|ref|YP_001643655.1|
Sequence length 117
Comment hypothetical protein BcerKBAB4_0767 [Bacillus weihenstephanensis KBAB4]
Sequence
MTKNIHDVAYELQKTIAENEDFQTLKASYAAVQGDAESKNLFEEFRAMQLGLQQKMMQGQ
EITEEDNQKAQEVVARIQQDAKITKLMETEQRLNIVITDVNKIIMKPLEELYSAQQA
Download sequence
Identical sequences A0A084IXF9 A0A150C243 A0A1I6BXB5 A9VGI1 J8CMJ0 J8ICZ8 J8K2D5 J8L3Z6 J8PIJ1 R8EYX8 R8HQG6 W4EHK4
315730.BcerKBAB4_0767 gi|163938771|ref|YP_001643655.1| WP_002125511.1.100646 WP_002125511.1.100649 WP_002125511.1.17940 WP_002125511.1.20051 WP_002125511.1.20881 WP_002125511.1.27729 WP_002125511.1.27732 WP_002125511.1.2902 WP_002125511.1.2904 WP_002125511.1.31050 WP_002125511.1.35095 WP_002125511.1.36226 WP_002125511.1.37635 WP_002125511.1.37801 WP_002125511.1.38645 WP_002125511.1.4354 WP_002125511.1.46157 WP_002125511.1.47674 WP_002125511.1.54007 WP_002125511.1.59016 WP_002125511.1.6426 WP_002125511.1.68186 WP_002125511.1.75292 WP_002125511.1.82832 WP_002125511.1.8290 WP_002125511.1.85012 WP_002125511.1.85187 WP_002125511.1.86789 WP_002125511.1.87416 WP_002125511.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]