SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163938868|ref|YP_001643752.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938868|ref|YP_001643752.1|
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.49e-16
Family ArsR-like transcriptional regulators 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163938868|ref|YP_001643752.1|
Sequence length 103
Comment ArsR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MEPLLIYKALSNETRCQILSWLKNPENHFDEKPYLEQGLSFQVGVCVGDIQLKTGLAQSV
ISSYLLTMKKAGLLDSDRIGKWTYYRRNENTIREFSEYVQNEL
Download sequence
Identical sequences A9VHC9
gi|163938868|ref|YP_001643752.1| 315730.BcerKBAB4_0868 WP_012260464.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]