SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163938942|ref|YP_001643826.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163938942|ref|YP_001643826.1|
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.98e-21
Family Phage repressors 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163938942|ref|YP_001643826.1|
Sequence length 149
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MIFSERLKEEREKRNWSQNDLAEKIHVSRQSVSKWETGKNYPSIEIIIHLSDLFGITIDE
LLRSDEELTQKVIEDSKQLAYPKWKVFFDSLFMMGVFLFITKIVVWALNKFAGASITIVA
DAPYVMNFLPLLLMIIGGTVSDKLKKIYR
Download sequence
Identical sequences A0A109GB07 A0A1S9TPF8 A0A243AQH0 A9VI55 J7W2C9 J7ZVZ7 J8I8K8 R8HRA7 R8NAD3
315730.BcerKBAB4_0945 gi|163938942|ref|YP_001643826.1| WP_002087188.1.11324 WP_002087188.1.17940 WP_002087188.1.31050 WP_002087188.1.37801 WP_002087188.1.39896 WP_002087188.1.45835 WP_002087188.1.52845 WP_002087188.1.60236 WP_002087188.1.6426 WP_002087188.1.64566 WP_002087188.1.75292 WP_002087188.1.85012 WP_002087188.1.86789 WP_002087188.1.93582 WP_002087188.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]