SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939051|ref|YP_001643935.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939051|ref|YP_001643935.1|
Domain Number 1 Region: 3-483
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.44e-209
Family Heme-dependent catalases 0.000000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163939051|ref|YP_001643935.1|
Sequence length 488
Comment catalase [Bacillus weihenstephanensis KBAB4]
Sequence
MNPNKRLTTNQGAPVGDNQNSRTAGRRGPVLLEDYHLVEKLAHFDRERIPERVVHARGAG
AHGVFVTKNSMQQYTKAAFLQNEGTETPVFVRFSTVIHGQGSPETARDPRGFAVKFYTGE
GNYDIVGNHLPVFFIRDAIKFPDMVHSLKPAPDTNVQTPDRYWDFMTLTPESTHMMTWVF
SDYGTPANYREMEGFGVHSFKWINAEGKIVYIKYHWKPQQGVRNLSAKEVEQVQGKDFNH
ATRDLFDAIEKGNYPKWDLHVQVMQLDETDSLDFDPLDPTKVWPEDRFPLIEVGTMTLNR
NPKNFFAEVEQAAFTPSATVNGIEPSEDKLLQGRLFSYPDTQRYRLGANYLQIPVNCPYA
AVRNQQRDGAMQVDQNPSTINYEPSRHTENPVEDPAYRDSTMKVEGYVSREKIEKPNDFK
QAGERYRSFSKEEQDNLIANLTNDLKGVNEQTKLLAICNFFRADHDYGMRLAGALNVDIT
QYVGNVPK
Download sequence
Identical sequences A9VJ18 J8DC30
315730.BcerKBAB4_1058 gi|163939051|ref|YP_001643935.1| WP_002140813.1.85012 WP_002140813.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]