SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939166|ref|YP_001644050.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939166|ref|YP_001644050.1|
Domain Number 1 Region: 4-62
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000873
Family SinR domain-like 0.022
Further Details:      
 
Weak hits

Sequence:  gi|163939166|ref|YP_001644050.1|
Domain Number - Region: 128-173
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 0.00209
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939166|ref|YP_001644050.1|
Sequence length 221
Comment helix-turn-helix domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MSINNFGRDIKALRTKRKIGSRELSRLIGKAETYISQLERGLIKKPDYSTAYDIMKHLGF
TESGIKDFLYNFHQIKSPERIVTEAEEVENWEEKRAAEIEDILLQKQEEIDTDPEYHENR
LAHDLKNFESQWMMDLHEQLEDKNEEIKKELSFNINKNVQTFEPIINNLLSLLTSTRKDR
GNFNLFVGLFENDLSALSEESKEKILNTVKEEMNKQNQNNA
Download sequence
Identical sequences A9VJY6
315730.BcerKBAB4_1174 gi|163939166|ref|YP_001644050.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]