SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939188|ref|YP_001644072.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939188|ref|YP_001644072.1|
Domain Number 1 Region: 2-66
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 5.91e-19
Family SinR domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 72-106
Classification Level Classification E-value
Superfamily SinR repressor dimerisation domain-like 0.0000000000000562
Family SinR repressor dimerisation domain-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939188|ref|YP_001644072.1|
Sequence length 107
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MIGERIKRLRLQKGISLTELAEKAGVAKSYISSIERNLQKNPSIQFLEKIAAVLQIPVDT
LLHDETTTEGHLDSEWTQLVKDAMSSGVSKEQFREFLEFTQWKKNQQ
Download sequence
Identical sequences A0A084J505 A0A1I5ZJM2 A9VK08 C2SH15 J8II76 J8NR85 R8EX57 W4E808
WP_002030429.1.10033 WP_002030429.1.100646 WP_002030429.1.20051 WP_002030429.1.20881 WP_002030429.1.27729 WP_002030429.1.27732 WP_002030429.1.2902 WP_002030429.1.2904 WP_002030429.1.30061 WP_002030429.1.35095 WP_002030429.1.36226 WP_002030429.1.37635 WP_002030429.1.37801 WP_002030429.1.38645 WP_002030429.1.39255 WP_002030429.1.4354 WP_002030429.1.4496 WP_002030429.1.47957 WP_002030429.1.57105 WP_002030429.1.63476 WP_002030429.1.6426 WP_002030429.1.68186 WP_002030429.1.72867 WP_002030429.1.75292 WP_002030429.1.82832 WP_002030429.1.8290 WP_002030429.1.85187 WP_002030429.1.86789 WP_002030429.1.87416 WP_002030429.1.99558 WP_002030429.1.99908 gi|163939188|ref|YP_001644072.1| 315730.BcerKBAB4_1197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]