SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939333|ref|YP_001644217.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939333|ref|YP_001644217.1|
Domain Number 1 Region: 30-299
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.6e-83
Family Alanine racemase-like, N-terminal domain 0.00000226
Further Details:      
 
Domain Number 2 Region: 275-431
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 6.7e-51
Family Eukaryotic ODC-like 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939333|ref|YP_001644217.1|
Sequence length 438
Comment diaminopimelate decarboxylase [Bacillus weihenstephanensis KBAB4]
Sequence
MYLHGTSRINGQGHLEIGGCDTTQLAKQYGTPLYVYDEESIRGKCRAFHRAFKESGFSYQ
VAYASKAFLCMEMCRVAREENMSLDVVSGGELYTALQAGFPASRIHFHGNNKTEEEMIMA
LQANIGCFVVDNFLELEILHDLAMQHGKFVNILIRVTPGVEAHTHEYITTGQEDSKFGFG
VSNGQAMQAIELALQKSNYNVLGIHSHIGSQIFETAGFVRAIEVLRQFLEEVRERTHYVM
KVLNVGGGFGIRYTDSDTPLTLETYVHAVTSTIREQFTLCEYPLPEIWVEPGRSIVGDAG
TTLYTVGAVKEIPGIRKYVSVDGGMTDNLRPALYGARYEAMLANRGNDENEELVSIAGKC
CESGDMLIWDINLPQVASSDLLAISCTGAYGYSMANNYNRIRRPAVVFAKGGTSQIVVER
ETYENIIGNDRIRIKELV
Download sequence
Identical sequences A0A0A0WP25 A9VLI7 C2SHR9 J8D0B8 R8HT22
WP_002030676.1.17940 WP_002030676.1.30061 WP_002030676.1.4496 WP_002030676.1.57105 WP_002030676.1.85012 WP_002030676.1.86789 WP_002030676.1.99908 315730.BcerKBAB4_1342 gi|163939333|ref|YP_001644217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]