SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939338|ref|YP_001644222.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939338|ref|YP_001644222.1|
Domain Number 1 Region: 135-293
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.16e-41
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000498
Further Details:      
 
Domain Number 2 Region: 388-526
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00019
Further Details:      
 
Domain Number 3 Region: 14-134
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-30
Family Duplicated SiR/NiR-like domains 1 and 3 0.00079
Further Details:      
 
Domain Number 4 Region: 270-401
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.56e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163939338|ref|YP_001644222.1|
Sequence length 540
Comment ferredoxin--nitrite reductase [Bacillus weihenstephanensis KBAB4]
Sequence
MSYEKVWANNEKLNQTEKKKLEKDGLEIFNDIPYYAENGFESIPKEEWDAFKWAGLYLQR
PKEAGYFMMRVNIPSGIITNAQAEVLASIAEDYGRDVLDITTRQAIQFHWLEIGQIPDIF
KRLARVGLSSAGACGDITRNITGNPLAGIDANELFDTTSIVKEIYDYFQHNEEFSNLPRK
FKMSISSNIYNSANAEINCVAFTPATKEINGEEKVGFHIKIGGGLSARPYLAEELDVFVL
PEEVKAVSIAIATIFRDFGYREKRHLARLKFLVADWGAEKFKEKLVEYTGPLQSKGESAL
KGWNAGYFYGVQDQKQAGLKYVGFNVPVGRLHAKEMFEIARIAKQYGNGQIRTCNSQNFI
IPNVLPGNVAGLLSEPLFEAISANPKSFIGHAVSCTGIEYCNLALVETKERLRKIAEYLD
TQIALDVPVRIHMVGCPNSCGQRQIADIGLQGIKLKTKEKGIVEAFEIYVGGTLLDGGAY
NEKLKGKIDGEDLPDVLVSFLSYFQKNKLLAETFYDFVGRVGVEELQIVLNRVLEEVIAS
Download sequence
Identical sequences A9VLJ2
WP_012260617.1.99908 gi|163939338|ref|YP_001644222.1| 315730.BcerKBAB4_1347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]