SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939341|ref|YP_001644225.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939341|ref|YP_001644225.1|
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily Chelatase 6.21e-44
Family CbiX-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163939341|ref|YP_001644225.1|
Sequence length 250
Comment cobalamin (vitamin B12) biosynthesis CbiX protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKAVIYICHGSRLKAAKEEAVAFITSCMNRVEANIQEICFLELANPSIEEGFRTCVKRGA
TEIVAIPVFLLAAGHVKKDIPFELRKLNEEYPDIKIVYGNPFGVSEVLVKAVYNGSGIKD
YKEEVTLLLVARGSSDPETLQDIKWISSLFQKEENIKEVEVCYLAAAEPKFDERLKEIVE
QKERNIVVLPYLLFTGLLMKHVEKEVRQYESEEIKISPYLGKNVAFREMLIQKTEEILKG
DQYVSTYSAS
Download sequence
Identical sequences A0A0A0WPU8 A0A150C0I9 A0A1I5ZPJ1 A0A243A0D6 A9VLJ5 C2SHS7 J7WXT0 J8DA57 J8F427 J8NM16 J8PAD1 J8PJN8 J9CQQ5 R8EVJ0 R8HSI7 R8N637 W4E9P4
gi|163939341|ref|YP_001644225.1| WP_002030685.1.100646 WP_002030685.1.100649 WP_002030685.1.17940 WP_002030685.1.20051 WP_002030685.1.20881 WP_002030685.1.21695 WP_002030685.1.27729 WP_002030685.1.27732 WP_002030685.1.2902 WP_002030685.1.2904 WP_002030685.1.30061 WP_002030685.1.35095 WP_002030685.1.36226 WP_002030685.1.37635 WP_002030685.1.37801 WP_002030685.1.38645 WP_002030685.1.39255 WP_002030685.1.39896 WP_002030685.1.4354 WP_002030685.1.4496 WP_002030685.1.45835 WP_002030685.1.46157 WP_002030685.1.47674 WP_002030685.1.50411 WP_002030685.1.52845 WP_002030685.1.54007 WP_002030685.1.57105 WP_002030685.1.60236 WP_002030685.1.63476 WP_002030685.1.6426 WP_002030685.1.64566 WP_002030685.1.68186 WP_002030685.1.72867 WP_002030685.1.75292 WP_002030685.1.82832 WP_002030685.1.8290 WP_002030685.1.85012 WP_002030685.1.85187 WP_002030685.1.86789 WP_002030685.1.87416 WP_002030685.1.93582 WP_002030685.1.99908 315730.BcerKBAB4_1350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]