SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939402|ref|YP_001644286.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939402|ref|YP_001644286.1|
Domain Number 1 Region: 8-77
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000142
Family DNA-binding N-terminal domain of transcription activators 0.011
Further Details:      
 
Weak hits

Sequence:  gi|163939402|ref|YP_001644286.1|
Domain Number - Region: 192-254
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 0.0012
Family Cobalamin (vitamin B12)-binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163939402|ref|YP_001644286.1|
Sequence length 291
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MPNSNGKYNIKAVSNILGIQPSTLRAWERRYHIIAPKRNRAGHRLYTEEHIHILKWLMNK
VSEGMMIGQAVQLLEGNRLQNNVQKEKITDTEVVLVDDILQALLEFDEITISALLNEVFS
IYSTEKVVASIILQVANKLLTLKSNNEITMSQFKYVVSFLQTRLGMIYHNASVYSSVNKV
FVLENNILKGFIFATYLRLKGYQTMYMGTSLDEEGILLAIEQLQPKYLFISFDDERELEE
AVEFIDLLQEKNENISGGFIGRKGIGDQLNLQNILIGNTKEEWDGWLKMSE
Download sequence
Identical sequences A0A1W6A604 A9VLQ6 J8EIS3 J8P960
gi|163939402|ref|YP_001644286.1| 315730.BcerKBAB4_1411 WP_002166076.1.100649 WP_002166076.1.28299 WP_002166076.1.45835 WP_002166076.1.46157 WP_002166076.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]