SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939454|ref|YP_001644338.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939454|ref|YP_001644338.1|
Domain Number 1 Region: 72-276
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.31e-62
Family Biotin holoenzyme synthetase 0.000024
Further Details:      
 
Domain Number 2 Region: 3-61
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000272
Family Biotin repressor-like 0.03
Further Details:      
 
Domain Number 3 Region: 282-325
Classification Level Classification E-value
Superfamily C-terminal domain of transcriptional repressors 0.000016
Family Biotin repressor (BirA) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939454|ref|YP_001644338.1|
Sequence length 326
Comment biotin--acetyl-CoA-carboxylase ligase [Bacillus weihenstephanensis KBAB4]
Sequence
MQSTIRKQLLQVFSEADGAFVSGQILSDKLGCSRTAVWKHMEDLRNEGYELEAVRRLGYR
IASKPDKVTANEIQLGLQTERIGRTVYFEESVESTQHIAARLAYEGAEEGTIVVAEEQTA
GRGRLSRKWYSPKGTGIWMSIILRPSIPVHHAPQLTLLAAVSVAQAIEKCTGVNVGIKWP
NDILIQGKKAVGILTEMQADPDKINAVIMGIGINANQKQEHFDEEIQQIATSLAIESGKP
IVRAELMQQIFLQLEKLYEEYLKNGFSVIKILWESYAVSIGKEITARTMKETINGLAKGI
TEDGVLLLEDHQGQVHHIHSADIEIK
Download sequence
Identical sequences A0A084J5P7 A0A150C110 A0A1I5ZTS7 A0A2C9YMD6 A9VME8 J7W537 J7ZSX9 J8HT17 J8IHW9 J8NLR3 J8P9B3 J8PJC9 R8DEQ0 R8EVN5 R8HT89 W4EE19
315730.BcerKBAB4_1463 gi|163939454|ref|YP_001644338.1| WP_002086594.1.10033 WP_002086594.1.100646 WP_002086594.1.100649 WP_002086594.1.17940 WP_002086594.1.20051 WP_002086594.1.20881 WP_002086594.1.21695 WP_002086594.1.27729 WP_002086594.1.28299 WP_002086594.1.2902 WP_002086594.1.2904 WP_002086594.1.30061 WP_002086594.1.31050 WP_002086594.1.35095 WP_002086594.1.36226 WP_002086594.1.37635 WP_002086594.1.37801 WP_002086594.1.38645 WP_002086594.1.39255 WP_002086594.1.39317 WP_002086594.1.39896 WP_002086594.1.4354 WP_002086594.1.4496 WP_002086594.1.46157 WP_002086594.1.47674 WP_002086594.1.47957 WP_002086594.1.52845 WP_002086594.1.54007 WP_002086594.1.57105 WP_002086594.1.59016 WP_002086594.1.60236 WP_002086594.1.63476 WP_002086594.1.6426 WP_002086594.1.64566 WP_002086594.1.68186 WP_002086594.1.72867 WP_002086594.1.75292 WP_002086594.1.76817 WP_002086594.1.79293 WP_002086594.1.82832 WP_002086594.1.8290 WP_002086594.1.85012 WP_002086594.1.85187 WP_002086594.1.86789 WP_002086594.1.87416 WP_002086594.1.99558 WP_002086594.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]