SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939516|ref|YP_001644400.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939516|ref|YP_001644400.1|
Domain Number 1 Region: 126-273
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.44e-39
Family Multidrug-binding domain of transcription activator BmrR 0.032
Further Details:      
 
Domain Number 2 Region: 7-113
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.27e-25
Family DNA-binding N-terminal domain of transcription activators 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939516|ref|YP_001644400.1|
Sequence length 276
Comment MerR family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MLLNQRFTIGEMAKMHNIAESTLRYYDEKGIFHPSIVDPQTNYRYYTIDQFSLLDTIKFL
RQLNIPLKEIKKYIDERNPSYALNLLEKQQEMMLKKQREIEYALAKMEHKIHLMKKATKS
EANQIIYKKIPKRKITAIAVAPNTTDDMFEYYIHSLQKNMKQIDNSLFSGDIGVTVSKKA
LMQNEFQAYNSVFILLDYMPFEAHTSDEIKEGVFACSYHHGPYEETDATYTELLKHIDNE
GYEVCGDALELALIDWSVTENPKEQVTEIQIPVVKK
Download sequence
Identical sequences A9VNB8
315730.BcerKBAB4_1527 gi|163939516|ref|YP_001644400.1| WP_012260652.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]