SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939553|ref|YP_001644437.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939553|ref|YP_001644437.1|
Domain Number 1 Region: 115-326
Classification Level Classification E-value
Superfamily FliG 1.7e-48
Family FliG 0.00000883
Further Details:      
 
Domain Number 2 Region: 8-112
Classification Level Classification E-value
Superfamily FliG 0.0000000000000017
Family FliG 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163939553|ref|YP_001644437.1|
Sequence length 334
Comment flagellar motor switch protein G [Bacillus weihenstephanensis KBAB4]
Sequence
MLDEISSKEKAAILIRTLNEEVAAKVIEYMTAEEKEVLLREIAKFRVYKPETLENVLGEF
LYELNVKELNLVTPDKEYIRRIFKNMPEEDLEKLLEDLWYNKDNPFEFLNSLTDLEPLLT
VLNDESPQTIAIIASYIKPQLASQLIERLPDHKRVETVMGIAKLEQVDGELINQIGELLK
AKLNNMAFSAINKTDGLKTIVNILNNVSRGVEKTVFQKLDEVDYALSEKIKENMFVFEDL
LGLEDLALRRVLEEITDNGVIAKALKIAKEEIKEKLFTCMSSNRREMILEELDGLGPLKM
TDAEKAQQTITGTVKKLEKEGRIIVQRGEDDVLI
Download sequence
Identical sequences A9VNF5 C2PU27 C2XS28 J8CII8 J8HSQ2 R8DEM1 R8N6M5
WP_002012042.1.28299 WP_002012042.1.39317 WP_002012042.1.60236 WP_002012042.1.76817 WP_002012042.1.79293 WP_002012042.1.85012 WP_002012042.1.99908 gi|163939553|ref|YP_001644437.1| 315730.BcerKBAB4_1564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]