SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939593|ref|YP_001644477.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939593|ref|YP_001644477.1|
Domain Number 1 Region: 2-67
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000132
Family SinR domain-like 0.056
Further Details:      
 
Domain Number 2 Region: 188-396
Classification Level Classification E-value
Superfamily TPR-like 0.00000000164
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939593|ref|YP_001644477.1|
Sequence length 404
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MATLGEKIKTLRKEKKLTQTELAGSELTKSMLSQIENGKATPSMKTLQYIAEKLGCETSF
LLEEDDVEIVEIIQQMEQLIKANKCDEVYETLLPIVQKELPSTLNTARLYKQFVTAAAIM
KDYNIEYYVEKATSIFEKYTLYRDSTETKLKLSFTIFTRKKYGECLQLIASIRNDYEEKH
LEMDLIIHIELCLYEAIILLACGDYETCEKTILEALEFSKKHQVYFKTDEFYRILSYQKV
ITADKEQYLYYIKKSEQFAIFTEDTLSIAIIDILKAYYYNTITNEYTIALKHLEQFREKL
KDEPLFQDDGLYYLEKGKALYGLKRYEEALQALQRGIMPDYMNHPLDQAWLTTAGAYRAL
CYVKLNDKKRALEEATEAAQKIQSYPDSIFSSFIKETLQIIQKL
Download sequence
Identical sequences A0A0A0WPS2 A9VNJ5 J8P9M0 J8PLK4 R8H1D9
gi|163939593|ref|YP_001644477.1| WP_002189092.1.17940 WP_002189092.1.30061 WP_002189092.1.4496 WP_002189092.1.46157 WP_002189092.1.47674 WP_002189092.1.57105 WP_002189092.1.86789 WP_002189092.1.99908 315730.BcerKBAB4_1606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]