SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939634|ref|YP_001644518.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939634|ref|YP_001644518.1|
Domain Number 1 Region: 57-181
Classification Level Classification E-value
Superfamily RmlC-like cupins 4.57e-25
Family Hypothetical protein TM1112 0.085
Further Details:      
 
Domain Number 2 Region: 3-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 3.94e-18
Family SinR domain-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163939634|ref|YP_001644518.1|
Sequence length 181
Comment XRE family transcriptional regulator [Bacillus weihenstephanensis KBAB4]
Sequence
MENIDIGKKIEKQRKEKGLTSKELAKMAEITPSMLSQIERGSANPSIQTLKVLAKALDVP
TFSFLLEENNTDDLIVRSHKRKKMIIDNLSYELLSPDFTGNLATAIMTIPPNTASSENVL
EHKGEELAFVLDGKITLHLNEEEYTLETGDSVKIPAYLKHKWVNQFEKNAIVLFSVTPPI
F
Download sequence
Identical sequences A0A084J691 A0A150BUK2 A0A243AK67 A9VPH8 C2PUB6 C2SID7 J8F3A5 J8HZR1 J8K6B8 J8PCG0 J8PPF4 J9C889 R8CW06 R8DFL8 R8H1E2 W4EBX4
315730.BcerKBAB4_1649 WP_002012259.1.10033 WP_002012259.1.11324 WP_002012259.1.17940 WP_002012259.1.21695 WP_002012259.1.27732 WP_002012259.1.28299 WP_002012259.1.2904 WP_002012259.1.30061 WP_002012259.1.31050 WP_002012259.1.35095 WP_002012259.1.36226 WP_002012259.1.37635 WP_002012259.1.38645 WP_002012259.1.39255 WP_002012259.1.39317 WP_002012259.1.39896 WP_002012259.1.4496 WP_002012259.1.45835 WP_002012259.1.46157 WP_002012259.1.47674 WP_002012259.1.47957 WP_002012259.1.50411 WP_002012259.1.54007 WP_002012259.1.57105 WP_002012259.1.59016 WP_002012259.1.6426 WP_002012259.1.64566 WP_002012259.1.68668 WP_002012259.1.72867 WP_002012259.1.75292 WP_002012259.1.79293 WP_002012259.1.82832 WP_002012259.1.8290 WP_002012259.1.86789 WP_002012259.1.93582 WP_002012259.1.99558 WP_002012259.1.99908 gi|163939634|ref|YP_001644518.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]