SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939759|ref|YP_001644643.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939759|ref|YP_001644643.1|
Domain Number 1 Region: 13-379,412-430
Classification Level Classification E-value
Superfamily Thiolase-like 4.36e-78
Family Thiolase-related 0.00096
Further Details:      
 
Domain Number 2 Region: 530-662,722-817
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 2.09e-67
Family FabD-like 0.0006
Further Details:      
 
Domain Number 3 Region: 1037-1311
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.12e-27
Family Tyrosine-dependent oxidoreductases 0.024
Further Details:      
 
Domain Number 4 Region: 907-976
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000563
Family Peptidyl carrier domain 0.0075
Further Details:      
 
Domain Number 5 Region: 660-718
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.000000222
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163939759|ref|YP_001644643.1|
Sequence length 1408
Comment Beta-ketoacyl synthase [Bacillus weihenstephanensis KBAB4]
Sequence
MNDSAQEPIRNGIEIAIIGMSCRFPGGDTINEFWENLKNGVESVTFFTDKELQKGGIDLE
TIQNPNYIKAGGAITGTEWFDNKLFNYSPRELEVMDPQLKILHECAWEALESSAYFSDNF
NGLIGTYIGASTNLYWLEAVYDGAKDFMKEAEFLNGSQFFGTRLSHKLNLKGPSYTVQTA
CSSSLVAVHLACQALLSGDCDIALAGGVSLTLPEKRGYLYKDGMILSPDGHCRPFDDNAR
GTVNGNGAGIVVLKRMEDAIADGDFIHAVVKGSAINNDGADKVSFNAPSVEGQAAVIRAA
HHMAEVESESISYVEAHGTGTMLGDPIEVEALKLAFNTEKNNFCGIGSVKGNIGHLDNAA
GIAGLIKTVVALENRMIPPSINYEKANEKINFGNSPFYVQDTLAEWKNQEFPLRAGVSSF
GMGGTNAHVVLEEPPQREASERSRRYQLLSFSAQTKKSLEEQTEKLAEYLNHNNNVNLAD
VAYTLLNGRKNLKYRRALVVSDIEEAKREFFIRNSAKVQTNICDGGSKQIIFMFPGQGAQ
YVNMGLDLYNEEKRFRDEVNLCCEILEEISGIDWKEVLYPKDLEARMRDDINQTSNTQPA
IFIFEYSLAKTLMEWGIYPDGMIGHSIGEYVAACLAGVFSLKQALQLVYERATLMQQLPK
GSMISVMASENEILPLMNQDVSIAAVNSPISCVISGSDEAIYTFEGELIRKGFQFKKLTT
SHAFHSSMMDSILDTYGKKLKEINFQDIKIPFISNSTGEWITEEQAKSADYWVNHLRHVV
EFSEGIKHLLSGTESIFVEVGPGRTLSSFVRQHTQGESKCPIINTVRHPKEKIFDDNYLL
QNIGKLHIHGVKINWSKYFSQERRYRVPLPTYPFERQFFSLSKDIEMEESSPLSQSDYVE
ELKRNVVPKDDKQRKIIESYKRVTGVKQVSIHDDFFELGGSSLTAINVVSSLQKDFDISI
NHLFEYPRVSDLAQHMTYKKEKTIPDALATYLIARGERHRLMEEKIRGDIAIRSLYDDRN
KKYYEINLSCQTGYKEVLLTGSTGYLGVYLLHDLLTELDCNVHLIVRSDNCIKAGNRIKE
KVCSYFGTSFYDKYKKRIFVYSGDLTKKYMGLDLPNYQYLSETIQCIIHSAGSVSHYGKY
EKSYEANVLATRNVIDFSLKGVKKDVNHISTLAVASGVVKNNEDILYTEYDNDLGQIIEN
PYPKTKLEAEKIVLETREKGINVNVFRVGNIGFDSKTGRFQENIEQNALYSMMKSYIRIG
LVPEMERDIDFACVNDVSQAIIKLFNKKELMNETHHIFNPNYVSLSALLTTYGLDIDVKE
TSIDKFIDYIFDEKQFNQYASDIYNLQLHCIGDELKTFNDVEQTLFHIMGDKTNMLLRKT
GFVWNNITDEMTKKMIRYGQKVNYFEKH
Download sequence
Identical sequences A9VQN0
WP_012260753.1.99908 315730.BcerKBAB4_1781 gi|163939759|ref|YP_001644643.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]