SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|163939805|ref|YP_001644689.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939805|ref|YP_001644689.1|
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.12e-58
Family AadK C-terminal domain-like 0.0000469
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.49e-49
Family AadK N-terminal domain-like 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939805|ref|YP_001644689.1|
Sequence length 292
Comment adenylyltransferase [Bacillus weihenstephanensis KBAB4]
Sequence
MRTEKEMLDLIINTAKEDERIRAVIMNGSRVNPNVKKDCFQDYDIIYVVKDIQSFTCNHS
WINRFGEIMIVQMPEEMSLLPADKDGKFPYLMQFMDGNRIDLMLVPVDLINKFIGQDSLS
KLLLDKDKCIGEFPPASDKDYVIKNPTEKEFLDCCNEFWWCSTNVGKGLWREELSYAKGM
LEGPMRDMLIVMLEWHIGMKTNFTVNTGKFGKHFEQYVEKDTWEQFRNTFSNAEYENIWE
SFFVMGDLFREVANEIANTYGYQYPQDDDDKVTSYLKHVKVLPKGSTSIYPA
Download sequence
Identical sequences A9VQS6
gi|163939805|ref|YP_001644689.1| WP_012260764.1.99908 315730.BcerKBAB4_1828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]