SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939831|ref|YP_001644715.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939831|ref|YP_001644715.1|
Domain Number 1 Region: 6-303
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.62e-44
Family Patatin 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|163939831|ref|YP_001644715.1|
Sequence length 321
Comment patatin [Bacillus weihenstephanensis KBAB4]
Sequence
MKIDGVFEGGGVRGIAHVGAICALAEKGYEWERLAGTSAGAIIAALLAAGYSCSELKTIV
TDIDYEKFTKKTFLDKIPFIGKGLSAWSTLGIYSNVFLEEWLEDLLRKKGIHLFTDLPDL
NKLKIIASDISNGKMVIFPDDLPNYGFLNYRFSIAKAVRMSGTIPFFFEPVKWRTPKWKQ
PCYMVDGGILSNYPIWIFDSPTSPRWPTFGFHFVKDEIQADPAHYDEPISMFKGLFKTMM
QAHDLRHLDKESKARTITIPTGIITSTNFQLTKEEKEWLYNSGYNAANKFLQSWNFRQYV
DEYRDGNQDRKTNRYFRQLDS
Download sequence
Identical sequences A0A1S9T2X9 A9VRQ2 J8D6Z9 J8L529 J8NTD0 R8HLG7
WP_002141372.1.100649 WP_002141372.1.17940 WP_002141372.1.46157 WP_002141372.1.47674 WP_002141372.1.85012 WP_002141372.1.86789 WP_002141372.1.99908 315730.BcerKBAB4_1855 gi|163939831|ref|YP_001644715.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]