SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939906|ref|YP_001644790.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939906|ref|YP_001644790.1|
Domain Number 1 Region: 30-266
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.11e-65
Family Alanine racemase-like, N-terminal domain 0.0000111
Further Details:      
 
Domain Number 2 Region: 261-398
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 5.23e-53
Family Alanine racemase 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163939906|ref|YP_001644790.1|
Sequence length 408
Comment alanine racemase [Bacillus weihenstephanensis KBAB4]
Sequence
MKREIEWNVIIELGVRPMSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKAN
GYGHGAVEVAKSAIEAGINQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDV
MMTVYRVEDLQGIDEVANHLQKKVRIHVKIDTGMSRIGLQEEEVKPFFEELKRMRYVEVV
GMFTHYSTADEIDKTYTNMQTSLFEKAVNTAEELGIHFPYIHSSNSAGSMELSNTFQNMV
RVGIGIYGMYPSREVDHTVASLQPALSLKSKVAHVKHAKKNRGVSYGNTYVTTGEEWIAT
VPIGYADGYNRQLSNKGHALINGVRVPVIGRVCMDQLMLDVTNAMPVQVGDEVVFYGKQD
EEEIAVEEIADMLGTINYEVTCMLDRRIPRVYKENDETTAIVNILRKN
Download sequence
Identical sequences A9VRX7 C2SJ66
315730.BcerKBAB4_1931 gi|163939906|ref|YP_001644790.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]