SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939936|ref|YP_001644820.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939936|ref|YP_001644820.1|
Domain Number 1 Region: 3-270
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 7.45e-47
Family ROO N-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939936|ref|YP_001644820.1|
Sequence length 321
Comment beta-lactamase domain-containing protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKKVEQLSSHLYLIDDYDLQHDERTGTYVLLGDDITLIETCAAPSLPYILDGLQQLHINL
NDVKNIIVTHVHLDHAGAAGLMMEKCPNATLFVHPRGARHMIDPTKLILGAKAVYKEDFD
KLFDPILPIEKERVHIVQNGDTLKIAEDRTLTFYDTPGHAKHHISIHDSLTNGIFTGDTI
GIYYRELADLDVELYLPSTSPSQFQPDAMIASKNHIQSMNVDTIYFGHYGASSNVTEVYN
QLEHWLPIFVNTGNEIFQKHTDFDEATKALQSLLLEKVSTHLTKLNVPSNHSVYNILHLD
LEISAMGIIDYLTKQTKSTIN
Download sequence
Identical sequences A9VSV3
WP_012260803.1.99908 315730.BcerKBAB4_1963 gi|163939936|ref|YP_001644820.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]