SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939959|ref|YP_001644843.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939959|ref|YP_001644843.1|
Domain Number 1 Region: 1-233
Classification Level Classification E-value
Superfamily Chelatase 1.31e-46
Family CbiX-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939959|ref|YP_001644843.1|
Sequence length 236
Comment cobalamin (vitamin B12) biosynthesis CbiX protein [Bacillus weihenstephanensis KBAB4]
Sequence
MKGIVYVGHGSRLREGNEQFIHFIQSVMKERNERSQKIAFLELTTPTISDAVTEAILEGA
TKILIVPVLLFAAAHYKRDIPFEIEQLQKKYPHITFSVVPPFSTHPHMVELVVKRIRETM
PKQDSSVLLVGRGSSDPQPIHELQQIGAAVERKLGMPVSCSFLTKGAPSFTADLKTITST
ASHVYVMPYLLFTGLLLQKIKLHTKKYDHVTTCNCLQFDTYMKLALLERMEECVYV
Download sequence
Identical sequences A0A1C3T7S2 A9VSX6
gi|163939959|ref|YP_001644843.1| 315730.BcerKBAB4_1987 WP_012260811.1.47957 WP_012260811.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]