SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939962|ref|YP_001644846.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939962|ref|YP_001644846.1|
Domain Number 1 Region: 624-769
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2-190
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.88e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0011
Further Details:      
 
Domain Number 3 Region: 140-305
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.41e-27
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0035
Further Details:      
 
Domain Number 4 Region: 490-614
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939962|ref|YP_001644846.1|
Sequence length 800
Comment nitrite reductase (NAD(P)H) large subunit [Bacillus weihenstephanensis KBAB4]
Sequence
MKKHLVMIGNGMAGIRCMEEILKHSDSYEITIFGDEPHPNYNRIMLSHVLQGKTNMQDII
MNEYSWYEENEITLYTNERVQSINREEKVIVTEKNRTLTYDKLIIATGSSAFILPVEGST
LPGVTGFRTIEDTQFMMDTAKEKKKAVVIGGGLLGLEAARGLIDLGMDVHVVHLMPSLME
QQLDTKAASLLREDLEAQGMKFLMEKKTVKILGTDHVEGIQFEDGEVVDCNLIVMAVGIR
PNTQIAKDASLLVNRGIVVNDYMLTNDESIYAVGECAEHDGIAYGLVAPLYEQGAILAKH
ITNLQTNGYTGSIVGTQLKVAGCDLFSAGQIYEDDQTKAISIFDECKRSYKKVLIRDNKV
VGIVLYGDATDGTRLFSMLKKEEDIQEYTAASLLHKAGEESELDVATMSADDTICGCNGV
TKGTIVHAILEQELTTFEEVKGCTKAAGSCGKCRPLVEQVLAHTLGDAFDASAQSAGMCG
CTTLSRDEVVAAIHEKGLKSPKEVRNVLGFAHEDGCSKCRPALNYYLRMAIPEEYVDDKS
SRYVNERMNGNIQHDGTFSVIPRMYGGVTTADDLMKIAEVAKKYDVPLVKITGASRIGLY
GVKKQDLPNVWADLNMTSGYAYSKSLRNVKSCVGSRFCRFGTKDSLGLGMLLEQSLEMVD
TPHKMKMGVTGCPRNCAEVLTKDFGVVCVENGFQLYIGGNGGTEVREADFVMIVPTEDDV
LRIATAYMQYYRETGIYGERTAYWTERLGFDHIKEILQDTSMVTMLNDRFQTARSTYTEA
WGQALETKSLKAMYEVETVK
Download sequence
Identical sequences A0A1C3T8A8 A9VSX9
WP_012260813.1.47957 WP_012260813.1.99908 gi|163939962|ref|YP_001644846.1| 315730.BcerKBAB4_1990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]