SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163939986|ref|YP_001644870.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163939986|ref|YP_001644870.1|
Domain Number 1 Region: 12-197,384-637
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.58e-137
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000000359
Further Details:      
 
Domain Number 2 Region: 200-384
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 2.83e-51
Family ValRS/IleRS/LeuRS editing domain 0.0000378
Further Details:      
 
Domain Number 3 Region: 645-878
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.62e-49
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000177
Further Details:      
 
Domain Number 4 Region: 946-1014
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000654
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|163939986|ref|YP_001644870.1|
Sequence length 1033
Comment isoleucyl-tRNA synthetase [Bacillus weihenstephanensis KBAB4]
Sequence
MKKVDVKESAVGRETRIRKQWNEQGIFEQSIQNREGAQSFVFYEGPPTANGLPHVGHALG
RAIKDLVARYKTMAGYKVLRKAGWDTHGLPVELGVEKQLGISGKHEIEEYGIEPFIQKCK
ESVFTYEKQWREFTESIGYWVDMDDPYVTLENPYIESVWNILGTIHEKGLLYKGHRVSPY
CPSCQTSLSSHEVAQGYKTVKDLSATVKFKVKDSENEYFLGWTTTPWTLPANVALAVHPN
MEYVKAKQEGYVYIVAKERVQEVLKENYEVVSVHKGEELVNTSYTAPFPMKEVTNGYHVI
AADFVTADSGTGLVHIAPAYGEDDYKVVQSEGLSFLHVVDEKGEYTEAVPFLKGKFVKEC
DVDIVRYLAKEGLLYHKEKYEHSYPHCWRCDSPLLYYAGESWLIRTTEIKETFLRNNDSV
KWYPDHMKHGRFGKFLENMVDWNISRNRYWGTPLNVWECESCDHQFSPKSIAELRKHSTK
ETPEDLELHKPYVDEVKVCCEKCGSTMNRTPEVIDVWFDSGSMPFAQYHYPFENKELFEE
QFPADVIAEGIDQTRGWFYSLLAVSALYTGKVPYKRVLSLGHVLDEEGQKMSKSKGNALD
PVDLVNQFGADALRWALLVDSAPWNAKRFSERTVLEAKSKFVDTLVNVYSFYVLYANLDE
YNPKEKYEVKRTKLDEWVLSRLHSTTKKVRTALDDYQFTNAAREIAALVDEVSNWYVRRS
RNRFWESGMNPEKAAAYETLHEVLVTISKLIAPFTPFVAEDIHLNLEGRSVHLVDYPVVN
ESLIQPELEAEMDAVLQVVELGRSNRNQHSLKVKQPLAELVLLAHNENDMDWESYRDIIM
DELNVKAFHVELDETKYTSYQLKLNFKTAGPKFGKSVNAVNGWLKQLSKEEVQHFVSTER
AVYEVAPGEEVVVTAEDVLVEKVAKSGFSNTTNGQYTVMLDTNVTEELLQEGVAREFIRA
VQEYRKQLNLPVNLRVDVILDTEEELQQTLTNHKDLLEENLLVKQFTFGHLTNEDDELSL
GETKIRIKLNAAN
Download sequence
Identical sequences A9VT03
gi|163939986|ref|YP_001644870.1| WP_012260827.1.99908 315730.BcerKBAB4_2014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]