SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940019|ref|YP_001644903.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940019|ref|YP_001644903.1|
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily YaeB-like 1.44e-46
Family YaeB-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940019|ref|YP_001644903.1|
Sequence length 157
Comment hypothetical protein BcerKBAB4_2049 [Bacillus weihenstephanensis KBAB4]
Sequence
MFSVQPIAFVHNERKEIKDDEWGEVRSYITLTDMYTEESIQGIEDFSHIEVVFYFHKVTD
EQIQYFARHPRNNNDYPKVGIFAQRGKNRPNRIGATIVKVIKREGKSIIVEGLDAIDGTP
ILDIKPIMKEFMPKEEILQPKWVTDIMKQYWKGNKTK
Download sequence
Identical sequences A0A1C3T7X7 A0A1S9TIC8 A0A243AAV8 A9VTV9 J7WA28
gi|163940019|ref|YP_001644903.1| 315730.BcerKBAB4_2049 WP_002085895.1.100649 WP_002085895.1.11324 WP_002085895.1.47957 WP_002085895.1.52845 WP_002085895.1.64566 WP_002085895.1.99908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]