SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|163940135|ref|YP_001645019.1| from Bacillus weihenstephanensis KBAB4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|163940135|ref|YP_001645019.1|
Domain Number 1 Region: 13-248
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.26e-66
Family Alanine racemase-like, N-terminal domain 0.0000152
Further Details:      
 
Domain Number 2 Region: 241-381
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.81e-52
Family Alanine racemase 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|163940135|ref|YP_001645019.1|
Sequence length 398
Comment alanine racemase [Bacillus weihenstephanensis KBAB4]
Sequence
MNVNYGRHTIIEVDLNALQRNFQQYKQAIPFGTAIMTVVKANAYGHGAVPIAKAVIEAGT
SHLAVAFVDEGIELREAGITVPILIFGYTPYEAIVDAITYDLSMTVYTIEDLHAIEEVAS
QMEKNAYIHIKIDTGMSRIGLQLNEVTLFLQTLKCTKYIQVEGMYTHFACADERDKAYTL
MQQEVFQKAVSKAEELQIVIPWIHANNSAATIDMRETKGNMVRLGIALYGLYPSADVNQE
AISLQPILTFKSKVAHIKKVKKGNGVSYGATYTATGEEWIATIPVGYADGVSRQLSNKGF
VLIKDVKVPIIGRICMDQLMLDVTKIMPIHVGDEVVFYGNQGEESISVDCVADTLSTINY
EITCMLSRRIPRIYIKDNKPIEIINELRRSPISLCINE
Download sequence
Identical sequences A0A0D6T0T9 A9VF15
WP_012260906.1.10033 WP_012260906.1.99908 gi|163940135|ref|YP_001645019.1| 315730.BcerKBAB4_2170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]